denguenaweb

Medical interns’ reflections on their training in use of personal protective

Mastery Studying Ensures Appropriate Private Protecting Gear Use in Simulated Medical Encounters of COVID-19

Introduction: The right use of non-public protecting gear (PPE) limits transmission of significant communicable illnesses to healthcare employees, which is critically necessary within the period of coronavirus illness 2019 (COVID-19). Nonetheless, prior research illustrated that healthcare employees incessantly err throughout software and elimination of PPE. The purpose of this examine was to find out whether or not a simulation-based, mastery studying intervention with deliberate apply improves appropriate use of PPE by physicians throughout a simulated medical encounter with a COVID-19 affected person.

 

Strategies: 

  • This was a pretest-posttest examine carried out within the emergency division at a big, tutorial tertiary care hospital between March 31-April 8, 2020. A complete of 117 topics participated, together with 56 school members and 61 resident physicians. Previous to the intervention, all contributors acquired institution-mandated training on PPE use by way of an internet video and supplemental supplies.

 

  • Members accomplished a pretest expertise evaluation utilizing a 21-item guidelines of steps to appropriately don and doff PPE. Members had been anticipated to fulfill a minimal passing rating (MPS) of 100%, decided by an skilled panel utilizing the Mastery Angoff and Affected person Security standard-setting strategies. Members that met the MPS on pretest had been exempt from the academic intervention.

 

  • Testing occurred earlier than and after an in-person demonstration of correct donning and doffing strategies and 20 minutes of deliberate apply. The first final result was a change in evaluation scores of appropriate PPE use following our academic intervention. Secondary outcomes included variations in efficiency scores between school members and resident physicians, and variations in efficiency throughout donning vs doffing sequences.

 

Outcomes: All contributors had a imply pretest rating of 73.1% (95% confidence interval [CI], 70.9-75.3%). College member and resident pretest scores had been related (75.1% vs 71.3%, p = 0.082). Imply pretest doffing scores had been decrease than donning scores throughout all contributors (65.8% vs 82.8%, p<0.001). Participant scores elevated 26.9% (95% CI of the distinction 24.7-29.1%, p<0.001) following our academic intervention leading to all contributors assembly the MPS of 100%.

 

Conclusion: A mastery studying intervention with deliberate apply ensured the right use of PPE by doctor topics in a simulated medical encounter of a COVID-19 affected person. Additional examine of translational outcomes is required.

denguenaweb
denguenaweb
Anti-human IL-4 antibody
STJ15100046 250 µg
EUR 367.00
Description: This monoclonal antibody enables sensitive and specific detection of human IL-4 in immunoassays such as ELISA and ELISpot.
anti- IL-4 antibody
FNab09861 100µg
EUR 548.75
  • Recommended dilution: WB: 1:500 - 1:1000
  • Immunogen: interleukin 4
  • Uniprot ID: P05112
  • Gene ID: 3565
  • Research Area: Immunology, Cardiovascular, Signal Transduction
Description: Antibody raised against IL-4
anti- IL-4 antibody
FNab04278 100µg
EUR 585.00
  • Recommended dilution: WB: 1:500 - 1:2000
  • IHC: 1:50 - 1:100
  • Immunogen: interleukin 4
  • Uniprot ID: P05112
  • Gene ID: 3565
  • Research Area: Immunology, Cardiovascular, Signal Transduction
Description: Antibody raised against IL-4
anti- IL-4 antibody
FNab04279 100µg
EUR 585.00
  • Recommended dilution: WB: 1:500-1:5000
  • IHC: 1:20-1:200
  • Immunogen: interleukin 4
  • Uniprot ID: P05112
  • Research Area: Immunology, Cardiovascular, Signal Transduction
Description: Antibody raised against IL-4
anti- IL-4 antibody
LSMab09861 100 ug
EUR 386.00
Anti-IL-4 antibody
PAab04278 100 ug
EUR 412.00
Anti-IL-4 antibody
STJ93699 200 µl
EUR 197.00
Description: Rabbit polyclonal to IL-4.
Anti-IL-4 antibody
STJ93700 200 µl
EUR 197.00
Description: Rabbit polyclonal to IL-4.
Anti-IL-4 antibody
STJ96510 200 µl
EUR 197.00
Description: Rabbit polyclonal to IL-4.
mAb mouse anti-human IL-4
CT253 0.5 mg
EUR 260.00
Rabbit Polyclonal antibody Anti-CRBN
Anti-CRBN 50 µg
EUR 349.00
Recombinant Human IL-2 Protein
PROTP60568-4 50ug
EUR 317.00
Description: IL-2 is a powerful immunoregulatory lymphokine produced by T-cells in response to antigenic or mitogenic stimulation. IL-2/IL-2R signaling is required for T-cell proliferation and other fundamental functions which are essential for the immune response. IL-2 stimulates growth and differentiation of B-cells, NK cells, lymphokine activated killer cells, monocytes, macrophages and oligodendrocytes. Recombinant human IL-2 is a 15.5 kDa protein, containing 134 amino acid residues including one intrachain disulfide bond.
Recombinant Human IL-17F Protein
PROTQ96PD4-4 25ug
EUR 317.00
Description: IL-17F, a member of the IL-17 family of structurally related cytokines, has been shown to stimulate proliferation and activation of T-cells and PBMCs. IL-17F also regulates cartilage matrix turnover and inhibits angiogenesis. Recombinant human IL-17F is a disulfide-linked homodimer of 30.1 kDa, consisting of two 133 amino acid residue chains.
Recombinant Human IL-6 Protein
PROTP05231-4 20ug
EUR 317.00
Description: IL-6 is a pleiotropic cytokine that plays an important role in host defense by regulating immune and inflammatory responses. Produced by T cells, monocytes, fibroblasts, endothelial cells and keratinocytes, IL-6 has diverse biological functions. It stimulates B-cell differentiation and antibody production, synergizes with IL-3 in megakaryocyte development and platelet production, induces expression of hepatic acute-phase proteins, and regulates bone metabolism. IL-6 signals through the IL-6 receptor system that consists of two chains, IL-6R α and gp130. Murine IL-6 is inactive on human cells, while both human and murine are equally active on murine cells. Recombinant human IL-6 is a 20.9 kDa protein containing 184 amino acid residues.
Recombinant Human IL-3 Protein
PROTP08700-4 10ug
EUR 317.00
Description: IL-3 is a hematopoietic growth factor that promotes the survival, differentiation and proliferation of committed progenitor cells of the megakaryocyte, granulocyte-macrophage, erythroid, eosinophil, basophil and mast cell lineages. Produced by T cells, mast cells and eosinophils, IL-3 enhances thrombopoieses, phagocytosis, and antibody-mediated cellular cytotoxicity. Its ability to activate monocytes suggests that IL-3 may have additional immunoregulatory roles. Many of the IL-3 activities depend upon co-stimulation with other cytokines. IL-3 is species-specific, variably glycosylated cytokine. Recombinant human IL-3 is a 15.0 kDa globular protein containing 133 amino acid residues.
Anti-mouse IL-4 antibody
STJ15100035 250 µg
EUR 336.00
Description: This monoclonal antibody enables sensitive and specific detection of mouse IL-4 in immunoassays such as ELISA and ELISpot.
Anti-mouse IL-4 antibody
STJ15100036 500 µg
EUR 527.00
Description: This monoclonal antibody is recommended for neutralization of mouse IL-4 bioactivity.
Anti-mouse IL-4 antibody
STJ15100037 250 µg
EUR 367.00
Description: This monoclonal antibody enables sensitive and specific detection of mouse IL-4 in immunoassays such as ELISA and ELISpot.
Anti-IL-4 alpha antibody
STJ93702 200 µl
EUR 197.00
Description: Rabbit polyclonal to IL-4Ralpha.
Anti-IL-4 alpha antibody
STJ93703 200 µl
EUR 197.00
Description: Rabbit polyclonal to IL-4Ralpha.
Anti-IL-4 alpha antibody
STJ97665 200 µl
EUR 197.00
Description: Rabbit polyclonal to IL-4Ralpha.
Recombinant Human IL-12 p80 Protein
PROTP29460-4 10ug
EUR 317.00
Description: IL-12 is a disulfide-linked heterodimeric protein (p70), composed of two subunits, p35 and p40, which are encoded by two different genes. Accumulating data indicate that p40 secretion precedes that of IL-12 expression. In addition, to its ability to covalently bind to p35 to form IL-12, p40 can bind to p19 to form IL-23, or can form a homodimer designated as IL-12 p80. Elevated levels of IL-12 p80 are correlated with macrophage recruitment and increased inflammation in asthma and respiratory viral infection models. Recombinant human IL-12 p80 is an 80.0 kDa disulfide linked homodimer consisting of two p40 chains of IL-12.
Recombinant Human IL-13 Variant Protein
PROTP35225-4 10ug
EUR 317.00
Description: IL-13 is an immunoregulatory cytokine produced primarily by activated Th2 cells, and also by mast cells and NK cells. Targeted deletion of IL-13 in mice resulted in impaired Th2 cell development and indicated an important role for IL-13 in the expulsion of gastrointestinal parasites. IL-13 exerts anti-inflammatory effects on monocytes and macrophages and it inhibits the expression of inflammatory cytokines such as IL-1β, TNF-α, IL-6 and IL-8. IL-13 has also been shown to enhance B cell proliferation and to induce isotype switching resulting in increased production of IgE. Blocking of IL-13 activity inhibits the pathophysiology of asthma. Human and murine IL-13 is cross-species reactive. A variant of IL-13 shows enhanced functional activity compared with the wild type IL-13. PeproTech's genetic variant, termed human IL-13 analog, is a mature 114 amino acid protein with a substitution of Q for R at position 112.
Human Interleukin-4 (IL-4)
1-CSB-EP011659HU
  • EUR 380.00
  • EUR 214.00
  • EUR 1309.00
  • EUR 560.00
  • EUR 873.00
  • EUR 262.00
  • 0
  • 1
  • 2
  • 3
  • 4
  • 5
  • MW: 31 kDa
  • Buffer composition: Tris-based buffer with 50% glycerol.
Description: Recombinant Human Interleukin-4(IL-4) expressed in E.coli
IL-4, Interleukin-4, human
RC212-15 5ug
EUR 104.38
  • Product category: Proteins/Recombinant Proteins/Cytokines
IL-4
E13-015-1 10μg
EUR 161.00
IL-4
E13-015-2 50μg
EUR 505.00
IL-4
E21-050 10ug
EUR 343.00
IL-4
E21-D03 10ug
EUR 343.00
IL-4
E21-K15 10ug
EUR 343.00
IL-4
MO15071 500 ug
EUR 910.00
pAb rabbit anti-human IL-4 receptor
CT248 0.5 mg
EUR 184.00
Recombinant Human IL-16 (129 a.a.) Protein
PROTQ14005-4 10ug
EUR 317.00
Description: IL-16 is a CD8+ T cell-derived cytokine that induces chemotaxis of CD4+ T cells and CD4+ monocytes and eosinophils. Analysis by gel filtration suggests that, under physiological conditions, hIL-16 exists predominantly as a noncovalently linked multimer, but that some IL-16 may exist as a monomer. However, only the multimeric form appears to possess chemotactic activity, suggesting that receptor cross-linking may be required for activity. IL-16 also induces expression of IL-2 receptor (IL-2R) and MHC class II molecules on CD4 + T cells. Human and murine IL-16 show significant cross-species reactivity. Recombinant human IL-16 is a 13.5 kDa protein consisting of 130 amino acid residues.
mAb mouse anti-rat IL-4
CT028 0.5 mg
EUR 260.00
mAb mouse anti-rat IL-4
CT029 0.5 mg
EUR 260.00
pAb rabbit anti-rat IL-4
CT058 0.5 mg
EUR 184.00
mAb mouse anti-monkey IL-4
CT103 0.5 mg
EUR 260.00
mAb rat anti-mouse IL-4
CT324 0.5 mg
EUR 260.00
mAb rat anti-mouse IL-4
CT337 0.5 mg
EUR 260.00
IL-4, human recombinant
4137-10
EUR 278.00
IL-4, human recombinant
4137-1000
EUR 3704.00
IL-4, human recombinant
4137-50
EUR 697.00
Human IL-4 Protein
abx060798-20ug 20 ug
EUR 467.00
  • Shipped within 5-10 working days.
rec IL-4 (human)
H-9630.0002 2.0µg
EUR 261.00
rec IL-4 (human)
H-9630.0010 10.0µg
EUR 950.00
Recombinant Human IL-4
P0052 100ug
EUR 522.36
  • Formulation: pH7.4, Lyophilized from a 0.2um filtered solution in PBS with 5% trehalose
  • Reconstitution: Sterile distilled water
  • Purity: Greater than 95% by SDS-PAGE gel analyses
  • Uniprot ID: P05112
Description: Recombinant Human protein for IL-4
Recombinant Human IL-4
SJB02-03 10µg/vial
EUR 285.00
Recombinant Human IL-4
SJB02-05 100µg/vial
EUR 720.00
Recombinant Human IL-4
SJB02-06 30µg/vial
EUR 430.00
Interleukin-4/IL-4
E21-K74 10ug
EUR 343.00
Recombinant Human IL-8 (72 a.a.) (CXCL8) Protein
PROTP10145-4 25ug
EUR 317.00
Description: IL-8 is a proinflammatory CXC chemokine that can signal through the CXCR1 and CXCR2 receptors. It is secreted by monocytes and endothelial cells. IL-8 chemoattracts and activates neutrophils. Recombinant human IL-8 (monocyte-derived) is an 8.4 kDa protein containing 72 amino acid residues.
Human Interleukin-4 (IL-4) Antibody
32184-05111 150 ug
EUR 261.00
Swine IL-10 Recombinant Protein
R00021-4 5ug/vial
EUR 259.00
Description: IL-10 is an anti-inflammatory cytokine and a member of the IL-10 family of cytokines, which have indispensable functions in many infectious and inflammatory diseases. Swine IL-10 Recombinant Protein is purified interleukin-10 produced in yeast.
Mouse IL-13 Recombinant Protein
R00077-4 5ug/vial
EUR 259.00
Description: IL-13 is an important mediator of allergic inflammation and disease. In addition to effects on immune cells, IL-13 is implicated as a central mediator of the physiologic changes induced by allergic inflammation in many tissues. Mouse IL-13 Recombinant Protein is purified interleukin-13 produced in yeast.
Feline IL-6 Recombinant Protein
R00102-4 5ug/vial
EUR 259.00
Description: Interleukin-6 (IL-6) is an interleukin that acts as both a pro-inflammatory and anti-inflammatory cytokine. Feline IL-6 Recombinant Protein is purified interleukin-6 produced in yeast.
Feline IL-2 Recombinant Protein
R00387-4 5ug/vial
EUR 259.00
Description: Interleukin-2 (IL-2) is a cytokine produced by T-helper cells in response to antigenic or mitogenic stimulation. It is required for T-cell proliferation and other activities crucial to the regulation of the immune response. Feline IL-2 Recombinant Protein is purified interleukin-2 produced in yeast.
Mouse IL-17A Recombinant Protein
R00421-4 5ug/vial
EUR 259.00
Description: IL-17A is a member of the IL-17 family of cytokines, whose members are involved in numerous immune regulatory functions. IL-17 induces the production of many other cytokines, chemokines, and prostaglandins. Mouse IL-17A Recombinant Protein is purified interleukin-17A produced in yeast.
Dolphin IL-8 Recombinant Protein
R00423-4 5ug/vial
EUR 259.00
Description: Interleukin-8 (IL-8), also known as CXCL8, is an ELR-positive CXC family member chemokine produced by macrophages and other cell types such as epithelial cells. ELR-positive CXC chemokines such as IL-8 specifically induce the migration of neutrophils, and interact with chemokine receptors CXCR1 and CXCR2. Dolphin IL-8 Recombinant Protein is purified interleukin-8 produced in yeast.
Swine IL-21 Recombinant Protein
R00459-4 5ug/vial
EUR 259.00
Description: The cytokine interleukin-21 (IL-21) regulates the proliferation and differentiation of T and B lymphocytes, modulates the cytotoxic activity and survival of NK and CD8+ T cells, and suppresses the maturation of dendritic cells. Swine IL-21 Recombinant Protein is purified interleukin-21 produced in yeast.
Equine IL-1ra Recombinant Protein
R00651-4 5ug/vial
EUR 259.00
Description: Interleukin-1 Receptor Antagonist Protein (IL-1F3, IL-1ra) belongs to the IL-1 family of cytokines, whose members play key roles in the development and regulation of inflammation. IL-1 receptor antagonist (IL-1ra; IL-1F3) reduces inflammation by blocking the binding of the agonist receptor ligands. Equine IL-1 Receptor Antagonist Recombinant Protein is purified interleukin-1 receptor antagonist protein (IL-1F3, IL-1ra) produced in yeast.
IL-7 Interleukin-7 Human Recombinant Protein, His Tag
PROTP13232-4 Regular: 10ug
EUR 317.00
Description: IL-7 Human Recombinant produced in E.Coli is single, a non-glycosylated, Polypeptide chain containing 152 amino acids fragment (26-177) and having a total molecular mass of 21.97 kDa with an amino-terminal hexahistidine tag. ;The IL-7 His-Tag protein is purified by proprietary chromatographic techniques.
Feline IL-1 alpha Recombinant Protein
R01144-4 5ug/vial
EUR 259.00
Description: IL-1 alpha (IL-1α, IL-1F1) is a member of the interleukin 1 family of cytokines. IL-1 alpha is an inflammatory cytokine active in the initiation of the inflammatory reaction and in driving Th1 and Th17 inflammatory responses. Feline IL-1 alpha Recombinant Protein is purified interleukin-1 alpha cytokine produced in yeast.
Feline IL-1 beta Recombinant Protein
R00101-4 5ug/vial
EUR 259.00
Description: IL-1 beta (IL-1β) is a member of the interleukin 1 family of cytokines. The IL-1 beta cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. Feline IL-1 beta Recombinant Protein is purified interleukin-1 beta cytokine produced in yeast.
IL-4 Antibody
5137-200
EUR 370.00
IL-4 Antibody
5137-30T
EUR 146.00
IL-4 antigen
E6IE600107 20ug
EUR 343.00
IL-4 antigen
E6L00107 20ug
EUR 382.00
rHu IL-4
AK8329-0005 5µg Ask for price
rHu IL-4
AK8329-0020 20µg Ask for price
rHu IL-4
AK8329-0100 100µg Ask for price
rHu IL-4
AK8329-1000 1mg Ask for price
IL-4 antibody
PAab09861 100 ug
EUR 386.00
Human FibrOut 4, for brain, neural
4-21552 1 ml Ask for price
Human FibrOut 4, for brain, neural
4-21553 5 x 1 ml Ask for price
Recombinant Human 4-1BB Receptor Protein
PROTQ07011-4 20ug
EUR 317.00
Description: 4-1BB Receptor, a member of the TNF superfamily of receptors, is mainly expressed on the surface of a variety of T cells, but also found in B cells, monocytes, and various transformed cell lines. 4-1BB Receptor binds to 4-1BBL to provide a co-stimulatory signal for T lymphocytes. Signaling by 4-1BB Receptor has been implicated in the antigen-presentation process and generation of cytotoxic T cells. The human 4-1BB Receptor gene codes for a 255 amino acid type I transmembrane protein containing a 17 amino acid N-terminal signal sequence, a 169 amino acid extracellular domain, a 27 amino acid transmembrane domain and a 42 amino acid cytoplasmic domain. Recombinant human soluble 4-1BB Receptor is a 167 amino acid polypeptide (17.7 kDa), which contains the cysteine rich TNFR-like extracellular domain of 4-1BB Receptor.
Recombinant Human PF-4 (CXCL4) Protein
PROTP02776-4 20ug
EUR 317.00
Description: PF-4 is a CXC chemokine that is expressed in megakaryocytes and stored in the α-granules of platelets. PF-4 is chemotactic towards neutrophils and monocytes and has been shown to inhibit angiogenesis. Recombinant human PF-4 is a 7.8 kDa protein containing 70 amino acid residues, including the four highly conserved residues present in CXC chemokines.
Anti-IL-4 Antibody [11B11], Unconjugated-100ug
QAB81-100ug 100ug
EUR 149.00
Anti-IL-4 Antibody [11B11], Unconjugated-500ug
QAB81-500ug 500ug
EUR 233.00
Anti-IL-4 Antibody [11B11], APC-100ug
QAB81-APC-100ug 100ug
EUR 276.00
Anti-IL-4 Antibody [11B11], APC-25ug
QAB81-APC-25ug 25ug
EUR 131.00
Anti-IL-4 Antibody [11B11], PE-100ug
QAB81-PE-100ug 100ug
EUR 259.00
Anti-IL-4 Antibody [11B11], PE-25ug
QAB81-PE-25ug 25ug
EUR 141.00
Anti-Phospho-IL-4 alpha (Y497) antibody
STJ90720 200 µl
EUR 197.00
Description: Rabbit polyclonal to Phospho-IL-4Ralpha (Y497).
Interleukin 4 (IL-4) Antibody
abx234279-100ug 100 ug
EUR 551.00
  • Shipped within 5-12 working days.
IL-4, Interleukin-4, monkey
RC222-15 5ug
EUR 104.38
  • Product category: Proteins/Recombinant Proteins/Cytokines
IL-4, Interleukin-4, rat
RC252-15 5ug
EUR 104.38
  • Product category: Proteins/Recombinant Proteins/Cytokines
Human Interleukin 4,IL-4 ELISA KIT
201-12-0093 96 tests
EUR 440.00
  • This Interleukin 4 ELISA kit is validated to work with samples from whole blood, serum, plasma and cell culture supernatant.
Description: A quantitative ELISA kit for measuring Human in samples from biological fluids.
Human Interleukin 4, IL-4 ELISA KIT
CSB-E04633h-24T 1 plate of 24 wells
EUR 165.00
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Interleukin 4, IL-4 in samples from serum, tissue homogenates, cell culture supernates, saliva. A new trial version of the kit, which allows you to test the kit in your application at a reasonable price.
Human Interleukin 4, IL-4 ELISA KIT
1-CSB-E04633h
  • EUR 500.00
  • EUR 3402.00
  • EUR 1820.00
  • 0
  • 1
  • 2
  • Sample volume: 50-100ul
  • Detection wavelength: 450nm
  • Assay performance time: 1 to 4 hours.
Description: Quantitativesandwich ELISA kit for measuring Human Interleukin 4, IL-4 in samples from serum, tissue homogenates, cell culture supernates, saliva. Now available in a cost efficient pack of 5 plates of 96 wells each, conveniently packed along with the other reagents in 5 separate kits.
Human Interleukin 4 (IL-4) CLIA Kit
abx195899-96tests 96 tests
EUR 825.00
  • Shipped within 5-12 working days.
Human IL-4(Interleukin 4) ELISA Kit
EH0199 96T
EUR 476.25
  • Detection range: 31.25-2000 pg/ml
  • Uniprot ID: P05112
  • Alias: IL-4(Interleukin 4)/IL4/BCGF-1/BCGF1/BSF-1/BSF1
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml
Human Interleukin 4,IL-4 ELISA KIT
CN-03206H1 96T
EUR 434.00
Human Interleukin 4,IL-4 ELISA KIT
CN-03206H2 48T
EUR 284.00
Human Interleukin 4(IL-4)ELISA Kit
GA-E0132HM-48T 48T
EUR 289.00
Human Interleukin 4(IL-4)ELISA Kit
GA-E0132HM-96T 96T
EUR 466.00
Human Interleukin-4 (IL-4) ELISA Kit
LF-EK60025 1×96T
EUR 790.00
IL-4 Interleukin-4 Human Recombinant Protein
PROTP05112-1 Regular: 20ug
EUR 317.00
Description: Interleukin-4 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 130 amino acids and having a molecular mass of 15kDa. ;The IL-4 is purified by proprietary chromatographic techniques.
Human Interleukin 4(IL-4)ELISA Kit
QY-E04267 96T
EUR 361.00
Human IL-4 ELISA kit
CT203A 5-plate
EUR 462.00
Human IL-4 ELISPOT kit
CT232-PB2 2-plate
EUR 415.00
Human IL-4 ELISPOT kit
CT232-PB5 5-plate
EUR 568.00
Human IL-4 ELISPOT kit
CT232-PR2 2-plate
EUR 415.00
Human IL-4 ELISPOT kit
CT232-PR5 5-plate
EUR 556.00
Human IL-4 ELISPOT kit
CT232-T2 2-plate
EUR 360.00
Human IL-4 ELISPOT kit
CT232-T5 5-plate
EUR 579.00
human IL-4, His tag
E410A04-100 100μg
EUR 960.00
IL-4 ELISA KIT|Human
EF000163 96 Tests
EUR 689.00
IL-4 (CHO-expressed), Human
HY-P7042 50ug
EUR 555.00
IL-4 (Human) ELISA Kit
K4164-100
EUR 729.00
Human IL-4 ELISA kit
LF-EK50141 1×96T
EUR 648.00
Recombinant Human IL-4 Protein
PROTP05112-5 15ug
EUR 317.00
Description: IL-4 is a pleiotropic cytokine that regulates diverse T and B cell responses including cell proliferation, survival and gene expression. Produced by mast cells, T cells and bone marrow stromal cells, IL-4 regulates the differentiation of naive CD4+ T cells into helper Th2 cells, characterized by their cytokine-secretion profile that includes secretion of IL-4, IL-5, IL-6, IL-10, and IL-13, which favor a humoral immune response. Another dominant function of IL-4 is the regulation of immunoglobulin class switching to the IgG1 and IgE isotypes. Excessive IL-4 production by Th2 cells has been associated with elevated IgE production and allergy. Recombinant human IL-4 is a 15.1 kDa globular protein containing 130 amino acid residues.
Human IL-4 ELISA Kit
RK00003 96 Tests
EUR 521.00
Recombinant Human IL-4 Protein
RP00995 5 μg
EUR 136.00
Human IL-4 Recombinant Protein
R00230-5 5ug/vial
EUR 259.00
Description: IL-4 has many biological roles, including the stimulation of activated B-cell and T-cell proliferation, and the differentiation of CD4+ T-cells into Th2 cells. It is a key regulator in humoral and adaptive immunity. Human IL-4 Recombinant Protein is purified interleukin-4 produced in yeast.
Recombinant Human Interleukin-4/IL-4 (Human Cells)
CX03-10ug 10ug
EUR 146.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Recombinant Human Interleukin-4/IL-4 (Human Cells)
CX03-1mg 1mg
EUR 2283.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Recombinant Human Interleukin-4/IL-4 (Human Cells)
CX03-500ug 500ug
EUR 1613.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Recombinant Human Interleukin-4/IL-4 (Human Cells)
CX03-50ug 50ug
EUR 339.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Polyclonal Goat anti-GST α-form
GST-ANTI-1 50 uL
EUR 280.00
Polyclonal Goat anti-GST μ-form
GST-ANTI-2 50 uL
EUR 280.00
Polyclonal Goat anti-GST p-form
GST-ANTI-3 50 uL
EUR 280.00
Human CellExp? IL-4, Human Recombinant
6463-10
EUR 398.00
Human CellExp? IL-4, Human Recombinant
6463-50
EUR 1398.00
Individual Reaction Mix 4
G065-4 200 reactions
EUR 167.00
Human Interleukin 4 (IL-4) Detection Assay Kit
6803 1 kit
EUR 483.55
Description: Human Interleukin 4 (IL-4) Detection Assay Kit
Human Interleukin-4 (IL-4) Antibody (Biotin Conjugate)
32184-05121 150 ug
EUR 369.00
ELISA kit for Human IL-4 (Interleukin 4)
E-EL-H0101 1 plate of 96 wells
EUR 377.00
  • Gentaur's IL-4 ELISA kit utilizes the Sandwich-ELISA principle. The micro ELISA plate provided in this kit has been pre-coated with an antibody specific to Human IL-4. Standards or samples are added to the micro ELISA plate wells and combined with th
  • Show more
Description: A sandwich ELISA kit for quantitative measurement of Human IL-4 (Interleukin 4) in samples from Serum, Plasma, Cell supernatant
CLIA kit for Human IL-4 (Interleukin 4)
E-CL-H0100 1 plate of 96 wells
EUR 584.00
  • Gentaur's IL-4 CLIA kit utilizes the Sandwich- CLIA principle. The micro CLIA plate provided in this kit has been pre-coated with an antibody specific to Human IL-4 . Standards or samples are added to the micro CLIA plate wells and combined with the
  • Show more
Description: A sandwich CLIA kit for quantitative measurement of Human IL-4 (Interleukin 4) in samples from Serum, Plasma, Cell supernatant
Recombinant Human Interleukin-4/IL-4 (E. coli)
C050-10ug 10ug
EUR 168.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Recombinant Human Interleukin-4/IL-4 (E. coli)
C050-1mg 1mg
EUR 1836.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Recombinant Human Interleukin-4/IL-4 (E. coli)
C050-500ug 500ug
EUR 1298.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Recombinant Human Interleukin-4/IL-4 (E. coli)
C050-50ug 50ug
EUR 405.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
IL-4 Interleukin-4 Human Recombinant Protein, HEK
PROTP05112 Regular: 10ug
EUR 317.00
Description: IL-4 Human Recombinant produced in HEK cells is a glycosylated monomer, having a molecular weight range of 14-19kDa due to glycosylation.;The IL-4 is purified by proprietary chromatographic techniques.
IL-4 Interleukin-4 Human Recombinant Protein, CHO
PROTP05112-2 Regular: 10ug
EUR 317.00
Description: Interleukin-4 Human Recombinant produced in CHO is a single, non-glycosylated polypeptide chain containing 129 amino acids and having a molecular mass of 14 kDa, the glycosilation of IL-4 migrates as 18 kDa on SDS-PAGE.;The IL-4 is purified by proprietary chromatographic techniques.
pAb rabbit anti-rat IL-4 Biotin-labeled
CT060 0.5 mg
EUR 347.00
Anti-IL-4 Antibody [11B11], Qfluor 630-100ug
QAB81-QF630-100ug 100ug
EUR 225.00
Anti-IL-4 Antibody [11B11], Qfluor 630-500ug
QAB81-QF630-500ug 500ug
EUR 310.00
Anti-IL-4 Antibody [MP4-25D2], APC-100Tests
QAB82-APC-100Tests 100Tests
EUR 251.00
Anti-IL-4 Antibody [MP4-25D2], APC-25Tests
QAB82-APC-25Tests 25Tests
EUR 141.00
Anti-IL-4 Antibody [MP4-25D2], PE-100Tests
QAB82-PE-100Tests 100Tests
EUR 276.00
Anti-IL-4 Antibody [MP4-25D2], PE-25Tests
QAB82-PE-25Tests 25Tests
EUR 141.00
Recombinant Mouse Interleukin-4/IL-4
CK15-10ug 10ug
EUR 146.00
Description: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Recombinant Mouse Interleukin-4/IL-4
CK15-1mg 1mg
EUR 2283.00
Description: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Recombinant Mouse Interleukin-4/IL-4
CK15-500ug 500ug
EUR 1613.00
Description: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
Recombinant Mouse Interleukin-4/IL-4
CK15-50ug 50ug
EUR 339.00
Description: Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.
IL-4, Interleukin-4, murine (mouse)
RC232-15 5ug
EUR 104.38
  • Product category: Proteins/Recombinant Proteins/Cytokines
IL-4, murine recombinant
4138-10
EUR 256.00
IL-4, murine recombinant
4138-1000
EUR 3704.00
IL-4, murine recombinant
4138-50
EUR 767.00
IL-4, rat recombinant
4139-10
EUR 245.00
IL-4, rat recombinant
4139-1000
EUR 3530.00
IL-4, rat recombinant
4139-50
EUR 729.00
IL-4 Polyclonal Antibody
41560-100ul 100ul
EUR 252.00
IL-4 Polyclonal Antibody
41560-50ul 50ul
EUR 187.00
rHu IL-4 (cGMP)
AK9839-0000 1mg Ask for price
rHu IL-4 (cGMP)
AK9839-0100 100ug Ask for price
IL-4 Polyclonal Antibody
ABP52876-003ml 0.03ml
EUR 158.00
  • Immunogen information: Synthesized peptide derived from the Internal region of human IL-4
  • Applications tips:
Description: A polyclonal antibody for detection of IL-4 from Human. This IL-4 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human IL-4
IL-4 Polyclonal Antibody
ABP52876-01ml 0.1ml
EUR 289.00
  • Immunogen information: Synthesized peptide derived from the Internal region of human IL-4
  • Applications tips:
Description: A polyclonal antibody for detection of IL-4 from Human. This IL-4 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human IL-4
IL-4 Polyclonal Antibody
ABP52876-02ml 0.2ml
EUR 414.00
  • Immunogen information: Synthesized peptide derived from the Internal region of human IL-4
  • Applications tips:
Description: A polyclonal antibody for detection of IL-4 from Human. This IL-4 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human IL-4
IL-4 Polyclonal Antibody
ABP54878-003ml 0.03ml
EUR 158.00
  • Immunogen information: Synthesized peptide derived from the Internal region of human IL-4
  • Applications tips:
Description: A polyclonal antibody for detection of IL-4 from Human. This IL-4 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human IL-4

 

Medical interns’ reflections on their coaching in use of non-public protecting gear

 

Background: The present COVID-19 pandemic has demonstrated that private protecting gear (PPE) is important, to forestall the acquisition and transmission of infectious illnesses, but its use is commonly sub-optimal within the medical setting.

 

Coaching and training are necessary to make sure and maintain the secure and efficient use of PPE by medical interns, however present strategies are sometimes insufficient in offering the related information and expertise. The aim of this examine was to discover medical graduates’ experiences of the usage of PPE and establish alternatives for enchancment in training and coaching programmes, to enhance occupational and affected person security.

 

Strategies: This examine was undertaken in 2018 in a big tertiary-care educating hospital in Sydney, Australia, to discover medical interns’ self-reported experiences of PPE use, originally of their internship. Reflexive teams had been performed instantly after theoretical and sensible PPE coaching, throughout hospital orientation. Transcripts of recorded discussions had been analysed, utilizing a thematic method that drew on the COM-B (functionality, alternative, motivation – behaviour) framework for behaviour.

 

Outcomes: 80% of 90 eligible graduates participated. Many interns had not beforehand acquired formal coaching within the particular expertise required for optimum PPE use and had developed doubtlessly unsafe habits. Their experiences as medical college students in medical areas contrasted sharply with advisable apply taught at hospital orientation and impacted on their potential to domesticate appropriate PPE use.

 

Conclusions: Undergraduate educating needs to be in line with greatest apply PPE use, and embody sensible coaching that embeds appropriate and secure practices.

Social Media Survey and Net Posting Evaluation of the COVID-19 Response in China: Well being Employee Attitudes Towards Preparedness and Private Protecting Gear Shortages

 

Background: Understanding well being employee consciousness, attitudes, and self-confidence within the office can inform native and international responses towards rising infectious threats, just like the coronavirus illness 2019 (COVID-19) pandemic. Availability of accessible private protecting gear (PPE) is important to efficient care and prevention.
Strategies: We performed a cross-sectional survey from February 24 to 28, 2020, to evaluate COVID-19 preparedness amongst well being employees. As well as, we assessed developments from search engine internet crawling and text-mining information trending over the Sina Weibo platform from January 1 to March 3, 2020. Information had been abstracted on Chinese language outbreak preparedness.
Outcomes: Within the survey, we engaged 6350 individuals, of whom 1065 agreed to take part, and after an eligibility logic test, 1052 participated (16.6%). We accessed 412 web posts as to PPE availability.
Well being employees who had been happy with present preparedness to deal with COVID-19 had been extra more likely to be feminine, to acquire information concerning the extreme acute respiratory syndrome coronavirus 2 (SARS-CoV-2) outbreak from authorities organizations, and to contemplate their hospital ready for outbreak administration.
Well being employees with extra confidence of their talents to reply had been these with extra religion of their establishment’s response capacities. Components of readiness included having airborne an infection isolation rooms, customer management procedures, and coaching in precautions and PPE use. Each survey and internet submit assessments urged that well being employees in want had been unable to reliably get hold of PPE.
Conclusions: Well being employees’ self-confidence is determined by perceived institutional readiness. Failure to take care of accessible PPE stock for rising infectious illnesses preparedness suggests a failure to be taught key classes from the 2003-2004 SARS outbreak in China.

Utilizing Massive-Scale Additive Manufacturing as a Bridge Manufacturing Course of in Response to Shortages in Private Protecting Gear throughout the COVID-19 Outbreak

 

The worldwide coronavirus illness (COVID)-19 pandemic has led to a world scarcity of non-public protecting gear (PPE), with conventional provide chains unable to deal with the numerous demand resulting in important shortfalls. A variety of open and crowdsourcing initiatives have sought to deal with this shortfall by producing gear reminiscent of protecting face shields utilizing additive manufacturing strategies reminiscent of fused filament fabrication (FFF).
This paper stories the method of designing and manufacturing protecting face shields utilizing large-scale additive manufacturing (LSAM) to provide the main thermoplastic elements of the face protect. LSAM provides important benefits over different additive manufacturing applied sciences in bridge manufacturing situations as a real transition between prototypes and mass manufacturing strategies reminiscent of injection molding.
Within the context of manufacturing of COVID-19 face shields, the flexibility to provide the optimized elements in beneath 5 min in comparison with what would usually take 1 – 2 h utilizing one other additive manufacturing applied sciences meant that important manufacturing quantity might be achieved quickly with minimal staffing.

Dkk-1 Polyclonal Antibody

41928-100ul 100ul
EUR 252.00

Dkk-1 Polyclonal Antibody

41928-50ul 50ul
EUR 187.00

Dkk-1 Polyclonal Antibody

ABP53293-003ml 0.03ml
EUR 158.00
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

ABP53293-01ml 0.1ml
EUR 289.00
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

ABP53293-02ml 0.2ml
EUR 414.00
  • Immunogen information: Synthesized peptide derived from the C-terminal region of human Dkk-1
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-1 from Human, Mouse, Rat. This Dkk-1 antibody is for WB, IHC-P, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the C-terminal region of human Dkk-1

Dkk-1 Polyclonal Antibody

ES4292-100ul 100ul
EUR 279.00
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Dkk-1 Polyclonal Antibody

ES4292-50ul 50ul
EUR 207.00
Description: A Rabbit Polyclonal antibody against Dkk-1 from Human/Mouse/Rat. This antibody is tested and validated for WB, ELISA, IHC, WB, ELISA

Anti-Dkk-1 antibody

STJ97257 200 µl
EUR 197.00
Description: Rabbit polyclonal to Dkk-1.

Anti-Dkk-1 antibody

STJ98000 100 µl
EUR 234.00
Description: Mouse monoclonal to Dkk-1.

Human CellExp? DKK-1, Human Recombinant

7132-10
EUR 278.00

Human CellExp? DKK-1, Human Recombinant

7132-50
EUR 1132.00

Dkk-2

GT15222 100 ug
EUR 526.00

ELISA kit for Human DKK-1

EK5390 96 tests
EUR 553.00
Description: Enzyme-linked immunosorbent assay kit for quantification of Human DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.

Human DKK-1 PicoKine ELISA Kit

EK0867 96 wells
EUR 425.00
Description: For quantitative detection of human DKK1 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

Dkk-1 Polyclonal Conjugated Antibody

C41928 100ul
EUR 397.00

DKK-1 (CHO-expressed), Mouse

HY-P7154 50ug
EUR 762.00

Recombinant Mouse Dkk-1 Protein

RP01062 5 μg
EUR 183.00

Human DKK-1 ELISA kit (4×96T)

LF-EK50798 4×96T
EUR 2201.00

Dkk-3 antibody

22898-100ul 100ul
EUR 390.00

DKK-3 ELISA KIT|Human

EF000091 96 Tests
EUR 689.00

Recombinant Human Dkk-3 Protein

RP00355 10 μg
EUR 164.00

ELISA kit for Rat DKK-1

EK5668 96 tests
EUR 553.00
Description: Enzyme-linked immunosorbent assay kit for quantification of Rat DKK-1 in samples from serum, plasma, tissue homogenates and other biological fluids.

Human DKK-1(Dickkopf-related protein 1) ELISA Kit

EH0113 96T
EUR 524.10
  • Detection range: 31.25-2000 pg/ml
  • Uniprot ID: O94907
  • Alias: DKK1/dickkopf(Xenopus laevis) homolog 1/dickkopf homolog 1(Xenopus laevis)/dickkopf related protein-1/Dickkopf-1/dickkopf-related protein 1/Dkk-1/DKK-1/SKdickkopf-1 like
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 18.75pg/ml

Dkk-1 ELISA Kit (Human) : 96 Wells (OKAG00221)

OKAG00221 96 Wells
EUR 596.00
Description: Description of target: This gene encodes a protein that is a member of the dickkopf family. It is a secreted protein with two cysteine rich regions and is involved in embryonic development through its inhibition of the WNT signaling pathway. Elevated levels of DKK1 in bone marrow plasma and peripheral blood is associated with the presence of osteolytic bone lesions in patients with multiple myeloma.;Species reactivity: Human;Application: ELISA;Assay info: Quantitative Colorimentric Sandwich ELISA;Sensitivity: 63 pg/mL

Dkk-3 Polyclonal Antibody

ABP54542-003ml 0.03ml
EUR 158.00
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ABP54542-01ml 0.1ml
EUR 289.00
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ABP54542-02ml 0.2ml
EUR 414.00
  • Immunogen information: Synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160
  • Applications tips:
Description: A polyclonal antibody for detection of Dkk-3 from Human, Mouse. This Dkk-3 antibody is for WB, ELISA. It is affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific immunogenand is unconjugated. The antibody is produced in rabbit by using as an immunogen synthesized peptide derived from the Internal region of human Dkk-3 at AA rangle: 80-160

Dkk-3 Polyclonal Antibody

ES5541-100ul 100ul
EUR 279.00
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA

Dkk-3 Polyclonal Antibody

ES5541-50ul 50ul
EUR 207.00
Description: A Rabbit Polyclonal antibody against Dkk-3 from Human/Mouse. This antibody is tested and validated for WB, ELISA, WB, ELISA

Anti-Dkk-3 antibody

STJ92720 200 µl
EUR 197.00
Description: Rabbit polyclonal to Dkk-3.

Anti-Dkk-3 antibody

STJ98001 100 µl
EUR 234.00
Description: Mouse monoclonal to Dkk-3.

Human DKK-4 PicoKine ELISA Kit

EK0868 96 wells
EUR 455.00
Description: For Quantitative Detection of human DKK-4 in cell culture supernates, serum and plasma(heparin, EDTA).

Human DKK-3 PicoKine ELISA Kit

EK1323 96 wells
EUR 425.00
Description: For quantitative detection of human DKK-3 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).

Recombinant Human Dkk-3/DKK3 Protein

RP00209 10 μg
EUR 155.00

DKK-3 ELISA Kit (Human) (OKBB00603)

OKBB00603 96 Wells
EUR 505.00
Description: Description of target: Dickkopf-related protein 3 is a protein that in humans is encoded by the DKK3 gene. This gene encodes a protein that is a member of the dickkopf family. It is mapped to 11p15.3. The secreted protein contains two cysteine rich regions and is involved in embryonic development through its interactions with the Wnt signaling pathway. The expression of this gene is decreased in a variety of cancer cell lines and it may function as a tumor suppressor gene. Members of the Dkk-related family display unique patterns of mRNA expression in human and mouse tissues, and are secreted when expressed in 293T cells. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.;Species reactivity: Human;Application: ELISA;Assay info: Assay Methodology: Quantitative Sandwich Immunoassay;Sensitivity: <= 10 pg/mL

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]

VAng-1451Lsx-100g 100 µg
EUR 848.00
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc]

VAng-1451Lsx-1mg 1 mg
EUR 4724.00
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [His]

VAng-1453Lsx-100g 100 µg
EUR 1013.00
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [His]

VAng-1453Lsx-1mg 1 mg
EUR 4999.00
Description: Human Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-1mg 1 mg
EUR 6374.00
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-250g 250 µg
EUR 2470.00
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Strep]

VAng-1454Lsx-25g 25 µg
EUR 765.00
Description: Human Dkk-1, Fc tag, is expressed in HEK 293 cells. (Uniprot ID: NP_036374.1)

Recombinant Dkk-1 Protein (Thr 32-His 272) [His]

VAng-1455Lsx-500g 500 µg
EUR 4449.00
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)

Recombinant Dkk-1 Protein (Thr 32-His 272) [His]

VAng-1455Lsx-50g 50 µg
EUR 1013.00
Description: Mouse Dkk-1, His tag, is expressed in HEK 293 cells. (Uniprot ID: O54908)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]

VAng-1452Lsx-200g 200 µg
EUR 3844.00
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)

Recombinant Dkk-1 Protein (Thr 32-His 266) [Fc] [Avi]

VAng-1452Lsx-25g 25 µg
EUR 1013.00
Description: Biotinylated Human Dkk-1, Fc tag and Avi tag, is expressed in HEK 293 cells. (Uniprot ID: O94907-1)

Human DKK-3(Dickkopf-related protein 3) ELISA Kit

EH0114 96T
EUR 567.60
  • Detection range: 62.5-4000 pg/ml
  • Uniprot ID: Q9UBP4
  • Alias: DKK-3/Dickkopf-3/Dkk3/REIC
Description: Method of detection: Double Antibody, Sandwich ELISA;Reacts with: Homo sapiens;Sensitivity: 37.5pg/ml

Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]

VAng-1456Lsx-1mg 1 mg
EUR 5494.00
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 349) [His]

VAng-1456Lsx-50g 50 µg
EUR 848.00
Description: Mouse Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_056629.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]

VAng-1457Lsx-200g 200 µg
EUR 1123.00
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)

Recombinant Dkk-3 Protein (Pro 23-Ile 350) [His]

VAng-1457Lsx-20g 20 µg
EUR 380.00
Description: Human Dkk-3, His tag, is expressed in HEK 293 cells. (Uniprot ID: NP_001018067.1)

Hemokinin 1 (human)

B5318-1 1 mg
EUR 340.00

Endothelin-1 (1-15), amide, human

A1111-1 1 mg
EUR 722.00
Description: Endothelins are 21-amino acid vasoconstricting peptides produced primarily in the endothelium and have a key role in vascular homeostasis.

Haptoglobin, (Phenotype 1-1) Human Plasma

7536-1
EUR 321.00

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-10ug 10ug
EUR 156.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-1mg 1mg
EUR 2283.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-500ug 500ug
EUR 1613.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

Recombinant Human Dickkopf-Related Protein 2/DKK-2 (N-Fc, C-6His)

CC49-50ug 50ug
EUR 369.00
Description: Lyophilized from a 0.2 μm filtered solution of 20mM PB,150mM NaCl,pH7.2.

BNP (1-32), human

A1105-1 1 mg
EUR 177.00
Description: Basic natriuretic peptide (BNP), now known as B-type natriuretic peptide (also BNP) or GC-B, is a 32 amino acid polypeptide secreted by the ventricles of the heart in response to excessive stretching of heart muscle cells (cardiomyocytes).

IGF-1, human recombinant

P1016-.1 100 µg
EUR 763.00
Description: Insulin-like growth factor I (IGF-1) is a polypeptide endocrine hormone structurally similar to insulin and is mainly produced in the liver when stimulated by growth hormone. IGF-1 is a growth factor that stimulates the proliferation of various cell types including muscle, bone, and cartilage tissue

Neuregulin/Heregulin-1? (NRG-1?/HRG-1?), human recombinant protein

P1054-1 1 mg
EUR 3947.00
Description: Neuregulin (NRG) is a signaling protein for ErbB2/ErbB4 receptor heterodimers on the cardiac muscle cells and plays an important role in heart structure and function through inducing cardiomyocyte differentiation

IL1RL1 Human, Interleukin-1 Receptor Like-1 Human Recombinant Protein, Sf9

PROTQ01638-1 Regular: 10ug
EUR 317.00
Description: IL 1RL1 produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain (19-328 a.a.) and fused to an 8 aa His Tag at C-terminus containing a total of 318 amino acids and having a molecular mass of 36.0kDa.;IL 1RL1 shows multiple bands between 40-57kDa on SDS-PAGE, reducing conditions and purified by proprietary chromatographic techniques.

MMP-1 Matrix Metalloproteinase-1 Human Recombinant Protein

PROTP03956-1 Regular: 20ug
EUR 317.00
Description: MMP 1 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 393 amino acids (100-469a.a) and having a molecular mass of 45kDa. MMP 1 is fused to a 23 amino acid His-tag at N-terminus.

PSG1 Human, Pregnancy Specific Beta-1-Glycoprotein 1 Human Recombinant Protein, Sf9

PROTP11464-1 Regular: 10ug
EUR 317.00
Description: PSG1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 394 amino acids (35-419a.a.) and having a molecular mass of 44.6kDa (Molecular size on SDS-PAGE will appear at approximately 40-57kDa). PSG1 is expressed with a 6 amino acids His tag at C-Terminus and purified by proprietary chromatographic techniques.

Parathyroid hormone (1-34) (human)

A1129-1 1 mg
EUR 166.00
Description: Parathyroid hormone (1-34) (human), (C181H291N55O51S2), a peptide with the sequence H2N-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-OH, MW= 4117.72.

Amyloid ?-Peptide (1-42) (human)

B6057-.1 100 ug
EUR 276.00

ApoA-1, human recombinant protein

P1052-.1 100 µg
EUR 313.00
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

ApoA-1, human recombinant protein

P1052-1 1 mg
EUR 1553.00
Description: Apolipoprotein A-1 (ApoA-1) is a glycoprotein produced in the liver and intestine that is the major protein component of high density lipoprotein (HDL) particles. ApoA-1 is involved in the reverse transport of cholesterol from peripheral tissues to the liver for recycling and excretion.

WNT-1, human recombinant protein

P1068-1 1 mg
EUR 6940.00
Description: The WNT gene family compose of structurally related genes that encode secreted signaling proteins. These proteins have been involved in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis.

Recombinant Human ANG-1 Protein

PROTQ15389-1 20ug
EUR 317.00
Description: Angiopoietin-1 (Ang-1) is a secreted ligand for Tie-2, a tyrosine-kinase receptor expressed primarily on vascular endothelial cells and early hematopoietic cells. Ang-1/ Tie-2 signaling promotes angiogenesis during the development, remodeling, and repair of the vascular system. Transgenic mice lacking expression of either Ang-1 or Tie-2 fail to develop a fully functional cardiovascular system and die before birth. Postnatally, the angiogenic activity of Ang-1/Tie-2 is required during normal tissue repair and remodeling of the female endometrium in the menstrual cycle. Ang-1/Tie-2 signaling appears to be regulated by Angiopoietin-2 (Ang-2), a natural antagonist for Tie-2 that exerts its effects through an internal autocrine loop mechanism. In addition to suppressing endothelial cell activation by inhibiting the expression of adhesion and inflammatory molecules, Ang-1 enhances endothelial cell survival and capillary morphogenesis, and lessens capillary permeability. As such, Ang-1 has a potential to become an effective therapeutic agent for treating various endothelium disorders, including several severe human pulmonary diseases. The efficacy of cell-based Ang-1 gene therapy for acute lung injury (ALI) has recently been studied in a rat model of ALI (1). The results of this study show that such therapy can markedly improve lung condition and suggest that Ang-1 therapy may represent a potential new strategy for the treatment and/or prevention of acute respiratory distress injury (ARDI), a significant cause of morbidity and mortality in critically ill patients. Recombinant human ANG-1, derived from HeLa cells, is a C-terminal histidine tagged glycoprotein which migrates with an apparent molecular mass of 60.0 – 70.0 kDa by SDS-PAGE under reducing conditions. Sequencing analysis shows N-terminal sequences starting with Ser-20 and with Asp-70 of the 498 amino acid precursor protein.

Recombinant Human Gremlin-1 Protein

PROTO60565-1 50ug
EUR 317.00
Description: Gremlin-1 (isoform-1) belongs to a group of diffusible proteins which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. The interplay between TGF-β ligands and their natural antagonists has major biological significance during development processes, in which cellular response can vary considerably depending upon the local concentration of the signaling molecule. Gremlin is highly expressed in the small intestine, fetal brain, and colon and lower expression in brain, prostate, pancreas and skeletal muscle.  Gremlin-1 regulates multiple functions in early development by specifically binding to and inhibiting the function of BMP-2, -4, and -7.  It also plays a role in carcinogenesis and kidney branching morphogenesis. Recombinant Gremlin-1 is a 18.3  kDa protein containing 160 amino acid residues.

ORM1 Orosomucoid 1 Human protein

PROTP02763-1 Regular: 10ug
EUR 317.00
Description: The Human Orosomucoid 1 produced from Human pooled serum has a molecular mass of 21.56kDa (calculated without glycosylation) containing 183 amino acid residues.

Recombinant Human Galectin-1 Protein

PROTP09382-1 50ug
EUR 317.00
Description: Lectins, of either plant or animal origin, are carbohydrate binding proteins that interact with glycoprotein and glycolipids on the surface of animal cells. The Galectins are lectins that recognize and interact with β-galactoside moieties. Galectin-1 is an animal lectin that has been shown to interact with CD3, CD4, and CD45. It induces apoptosis of activated T-cells and T-leukemia cell lines and inhibits the protein phosphatase activity of CD45. Recombinant human Galectin-1 is a 14.5 kDa protein containing 134 amino acid residues.

Recombinant Human PECAM-1 Protein

PROTP16284-1 50ug
EUR 317.00
Description: PECAM is transmembrane glycoprotein that belongs to the Ig-related superfamily of adhesion molecules. It is highly expressed at endothelial cell junctions, and also expressed in platelets and in most leukocyte sub-types. The primary function of PECAM-1 is the mediation of leukocyte-endothelial cell adhesion and signal transduction. PECAM-1 has been implicated in the pathogenesis of various inflammation related disorders, including thrombosis, multiple sclerosis (MS), and rheumatoid arthritis. The human PECAM-1 gene codes for a 738 amino acid transmembrane glycoprotein containing a 118 amino acid cytoplasmic domain, a 19 amino acid transmembrane domain, and a 574 amino acid extracellular domain. Recombinant human PECAM-1 is a 572 amino acid glycoprotein comprising the extracellular domain of PECAM-1. Monomeric glycosylated PECAM-1 migrates at an apparent molecular weight of approximately 80.0-95.0 kDa by SDS-PAGE analysis under reducing conditions

(1-328) RAD51D (1-328 a.a.) Human Recombinant Protein

PROTO75771-1 Regular: 10ug
EUR 317.00
Description: RAD51D (1-328) Human Recombinant produced in E. coli is. a single polypeptide chain containing 351 amino acids and having a molecular mass of 37.4kDa. RAD51D (1-328) is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

NXPH1 Human, Neurexophilin 1 Human Recombinant Protein, Sf9

PROTP58417-1 Regular: 10ug
EUR 317.00
Description: NXPH1 Human Recombinant produced in Sf9 Baculovirus cells is a single, glycosylated polypeptide chain containing 259 amino acids (22-271) and having a molecular mass of 29.7kDa (Molecular size on SDS-PAGE will appear at approximately 28-40kDa).;NXPH1 is fused to 9 amino acid His-Tag at C-terminus and purified by proprietary chromatographic techniques.

Human KRAB-associated Protein 1 (KAP-1) AssayMax ELISA Kit

EK2802-1 96 Well Plate
EUR 477.00

Human Interleukin-1 beta (IL-1 beta) AssayMax ELISA Kit

EI2200-1 96 Well Plate
EUR 477.00

Human Interleukin-1-alpha (IL-1-alpha) AssayMax ELISA Kit

EI2301-1 96 Well Plate
EUR 477.00

Human Plasminogen Activator Inhibitor-1 (PAI-1) AssayMax ELISA Kit

EP1100-1 96 Well Plate
EUR 417.00

GAD1 iso1 Glutamate Decarboxylase 1 Isoform-1 Human Recombinant Protein

PROTQ99259-1 Regular: 20ug
EUR 317.00
Description: GAD1 iso1 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 617 amino acids (1-594 a.a) and having a molecular mass of 69.3kDa. GAD1 iso1 is fused to a 23 amino acid His-tag at N-terminus & purified by proprietary chromatographic techniques.

TGF-b-1 Transforming Growth Factor-beta 1 Human protein

PROTP01137-1 Regular: 2.5ug
EUR 1157.00
Description: Human Transforming Growth Factor-beta 1 purified from Human Platelets having a molecular mass of 25kDa.;The TGF-b 1 is purified by proprietary chromatographic techniques.

MCP-1 Monocyte Chemotactic Protein-1 Human Recombinant Protein (CCL2)

PROTP13500-1 Regular: 20ug
EUR 317.00
Description: Monocyte Chemotactic Protein-1 Human Recombinant also known as Monocyte Chemotactic and Activating Factor (MCAF) produced in E.Coli is a non-glycosylated, Polypeptide chain containing 76 amino acids and having a molecular mass of 8.6kDa. ;The MCP-1 is purified by proprietary chromatographic techniques.

Ac-Endothelin-1 (16-21), human

A1016-1 1 mg
EUR 84.00
Description: ENDOTHELIN-1 (ET-1), the principal peptide of the endothelin family, has been shown to have a variety of biological activities in both vascular and nonvascular tissues, including the heart, the kidney, and the central nervous system.

Amyloid Beta-Peptide (1-40) (human)

A1124-1 1 mg
EUR 189.00
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

Brain natriuretic peptide (1-32) (human)

B5442-1 1 mg
EUR 518.00

Human Hexokinase-1 AssayMax ELISA Kit

EH3101-1 96 Well Plate
EUR 477.00

Human Complexin-1 AssayMax ELISA Kit

EC3505-1 96 Well Plate
EUR 417.00

Human Glutaredoxin-1 AssayMax ELISA Kit

EG2153-1 96 Well Plate
EUR 417.00

OryzaExp? IGF-1 LR3, Human Recombinant

P1399-1
EUR 881.00

Leave a Reply

Your email address will not be published. Required fields are marked *